SSX3 monoclonal antibody (M03), clone 4A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SSX3 expression in transfected 293T cell line by SSX3 monoclonal antibody (M03), clone 4A11.
Lane 1: SSX3 transfected lysate(21.697 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SSX3 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SSX3.
Immunogen
SSX3 (NP_066294, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SSX3 expression in transfected 293T cell line by SSX3 monoclonal antibody (M03), clone 4A11.
Lane 1: SSX3 transfected lysate(21.697 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SSX3 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SSX3
Entrez GeneID
10214GeneBank Accession#
NM_021014Protein Accession#
NP_066294Gene Name
SSX3
Gene Alias
MGC119054, MGC14495
Gene Description
synovial sarcoma, X breakpoint 3
Omim ID
300325Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023246|OTTHUMP00000023247|synovial sarcoma, X breakpoint 3, isoform a
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com