SSX3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SSX3 protein.
Immunogen
SSX3 (NP_066294.1, 1 a.a. ~ 188 a.a) full-length human protein.
Sequence
MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SSX3 expression in transfected 293T cell line (H00010214-T01) by SSX3 MaxPab polyclonal antibody.
Lane 1: SSX3 transfected lysate(20.68 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SSX3
Entrez GeneID
10214GeneBank Accession#
NM_021014.2Protein Accession#
NP_066294.1Gene Name
SSX3
Gene Alias
MGC119054, MGC14495
Gene Description
synovial sarcoma, X breakpoint 3
Omim ID
300325Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023246|OTTHUMP00000023247|synovial sarcoma, X breakpoint 3, isoform a
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com