Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PSMD14 polyclonal antibody (A01)

  • Catalog # : H00010213-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant PSMD14.
  • Immunogen:
  • PSMD14 (AAH09524.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010213-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PSMD14
  • Gene Alias:
  • PAD1,POH1,rpn11
  • Gene Description:
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  • Gene Summary:
  • PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM
  • Other Designations:
  • 26S proteasome-associated pad1 homolog
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook