Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DDX39 (Human) Recombinant Protein (P01)

  • Catalog # : H00010212-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DDX39 full-length ORF ( NP_005795.2, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYIEQSR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 75.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010212-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DDX39
  • Gene Alias:
  • BAT1,BAT1L,DDXL,MGC18203,MGC8417,URH49
  • Gene Description:
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 39
  • Gene Summary:
  • This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. [provided by RefSeq
  • Other Designations:
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 transcript,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 39,UAP56-related helicase, 49 kDa,nuclear RNA helicase, DECD variant of DEAD box family
  • RSS
  • YouTube
  • Linkedin
  • Facebook