Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOPORS (Human) Recombinant Protein (Q01)

  • Catalog # : H00010210-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TOPORS partial ORF ( NP_005793, 98 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010210-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TOPORS
  • Gene Alias:
  • LUN,P53BP3,RP31,TP53BPL
  • Gene Description:
  • topoisomerase I binding, arginine/serine-rich
  • Other Designations:
  • OTTHUMP00000021182,OTTHUMP00000021184,OTTHUMP00000045227,retinitis pigmentosa 31 (autosomal dominant),topoisomerase I binding protein,tumor protein p53-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook