TOPORS monoclonal antibody (M01), clone 5G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen
TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOPORS on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOPORS is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TOPORS on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TOPORS
Entrez GeneID
10210GeneBank Accession#
NM_005802Protein Accession#
NP_005793Gene Name
TOPORS
Gene Alias
LUN, P53BP3, RP31, TP53BPL
Gene Description
topoisomerase I binding, arginine/serine-rich
Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000021182|OTTHUMP00000021184|OTTHUMP00000045227|retinitis pigmentosa 31 (autosomal dominant)|topoisomerase I binding protein|tumor protein p53-binding protein
-
Interactome
-
Disease
-
Publication Reference
-
TOPORS-mediated RAD51 SUMOylation facilitates homologous recombination repair.
Gurusamy Hariharasudhan, Seo-Yeon Jeong, Min-Ji Kim, Sung Mi Jung, Gwanwoo Seo, Ju-Ran Moon, Sumi Lee, In-Youb Chang, Younghoon Kee, Ho Jin You, Jung-Hee Lee.
Nucleic Acids Research 2022 Feb; 50(3):1501.
Application:IF, IP-WB, PLA-Ce, Human, HeLa cells.
-
Mitotic phosphorylation stimulates DNA relaxation activity of human topoisomerase I.
Hackbarth JS, Galvez-Peralta M, Dai NT, Loegering DA, Peterson KL, Meng XW, Karnitz LM, Kaufmann SH.
The Journal of Biological Chemistry 2008 Apr; 283(24):16711.
-
Mutations in TOPORS cause autosomal dominant retinitis pigmentosa with perivascular retinal pigment epithelium atrophy.
Christina F Chakarova, Myrto G Papaioannou, Hemant Khanna, Irma Lopez, Naushin Waseem, Amna Shah, Torsten Theis, James Friedman, Cecilia Maubaret, Kinga Bujakowska, Brotati Veraitch, Mai M Abd El-Aziz, De Quincy Prescott, Sunil K Parapuram, Wendy A Bickmore, Peter M G Munro, Andreas Gal, Christian P Hamel, Valeria Marigo, Chris P Ponting, Bernd Wissinger, Eberhart Zrenner, Karl Matter, Anand Swaroop, Robert K Koenekoop, Shomi S Bhattacharya.
American Journal of Human Genetics 2007 Nov; 81(5):1098.
Application:WB-Ce, Human, Human lymphoblastoid .
-
TOPORS-mediated RAD51 SUMOylation facilitates homologous recombination repair.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com