Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SDCCAG33 monoclonal antibody (M07), clone 2F1

  • Catalog # : H00010194-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SDCCAG33.
  • Immunogen:
  • SDCCAG33 (NP_005777, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010194-M07
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TSHZ1 expression in transfected 293T cell line by SDCCAG33 monoclonal antibody (M07), clone 2F1.

    Lane 1: TSHZ1 transfected lysate (Predicted MW: 117.9 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TSHZ1 is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • TSHZ1
  • Gene Alias:
  • NY-CO-33,SDCCAG33,TSH1
  • Gene Description:
  • teashirt zinc finger homeobox 1
  • Gene Summary:
  • This gene encodes a colon cancer antigen that was defined by serological analysis of recombinant cDNA expression libraries. The encoded protein is a member of the teashirt C2H2-type zinc-finger protein family and may be involved in transcriptional regulation of developmental processes. [provided by RefSeq
  • Other Designations:
  • serologically defined colon cancer antigen 33,teashirt family zinc finger 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook