Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SDCCAG33 polyclonal antibody (A01)

  • Catalog # : H00010194-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SDCCAG33.
  • Immunogen:
  • SDCCAG33 (NP_005777, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010194-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TSHZ1
  • Gene Alias:
  • NY-CO-33,SDCCAG33,TSH1
  • Gene Description:
  • teashirt zinc finger homeobox 1
  • Gene Summary:
  • This gene encodes a colon cancer antigen that was defined by serological analysis of recombinant cDNA expression libraries. The encoded protein is a member of the teashirt C2H2-type zinc-finger protein family and may be involved in transcriptional regulation of developmental processes. [provided by RefSeq
  • Other Designations:
  • serologically defined colon cancer antigen 33,teashirt family zinc finger 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook