Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALYREF purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00010189-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ALYREF protein.
  • Immunogen:
  • ALYREF (ACE87115.1, 1 a.a. ~ 257 a.a) full-length human protein.
  • Sequence:
  • MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Gene Name:
  • ALYREF
  • Gene Alias:
  • ALY,ALY/REF,BEF,REF,THOC4
  • Gene Description:
  • Aly/REF export factor
  • Gene Summary:
  • The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins. [provided by RefSeq
  • Other Designations:
  • THO complex 4; THO complex subunit 4; ally of AML-1 and LEF-1; bZIP enhancing factor; bZIP-enhancing factor BEF; tho4; transcriptional coactivator Aly/REF
  • RSS
  • YouTube
  • Linkedin
  • Facebook