TNK2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TNK2 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of TNK2 expression in Y-79 ( Cat # L042V1 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant TNK2.
Immunogen
TNK2 (AAH08884, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Sequence
QYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TNK2 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of TNK2 expression in Y-79 ( Cat # L042V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — TNK2
Entrez GeneID
10188GeneBank Accession#
BC008884Protein Accession#
AAH08884Gene Name
TNK2
Gene Alias
ACK, ACK1, FLJ44758, FLJ45547, p21cdc42Hs
Gene Description
tyrosine kinase, non-receptor, 2
Omim ID
606994Gene Ontology
HyperlinkGene Summary
This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-terminal to an SH3 domain. The protein may be involved in a regulatory mechanism that sustains the GTP-bound active form of Cdc42Hs and which is directly linked to a tyrosine phosphorylation signal transduction pathway. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq
Other Designations
activated Cdc42-associated kinase 1|activated p21cdc42Hs kinase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com