RBM5 monoclonal antibody (M01), clone 2B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RBM5.
Immunogen
RBM5 (AAH02957, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFED
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody (M01), clone 2B6.
Lane 1: RBM5 transfected lysate(61.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RBM5 over-expressed 293 cell line, cotransfected with RBM5 Validated Chimera RNAi ( Cat # H00010181-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM5 monoclonal antibody (M01), clone 2B6 (Cat # H00010181-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to RBM5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RBM5
-
Interactome
-
Publication Reference
-
RBM5 reduces small cell lung cancer growth, increases cisplatin sensitivity and regulates key transformation-associated pathways.
Julie J Loiselle, Justin G Roy, Leslie C Sutherland.
Heliyon 2016 Nov; 2(11):e00204.
Application:WB-Ce, Human, GLC20 cells.
-
RBM5 reduces small cell lung cancer growth, increases cisplatin sensitivity and regulates key transformation-associated pathways.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com