ODZ1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ODZ1 partial ORF ( NP_055068, 2616 a.a. - 2725 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ODZ1
Entrez GeneID
10178GeneBank Accession#
NM_014253Protein Accession#
NP_055068Gene Name
ODZ1
Gene Alias
ODZ3, TEN-M1, TNM, TNM1
Gene Description
odz, odd Oz/ten-m homolog 1(Drosophila)
Omim ID
300588Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000024333|OTTHUMP00000062724|odz (odd Oz/ten-m, Drosophila) homolog 1|odz (odd Oz/ten-m, Drosophila) homolog 3|odz, odd Oz/ten-m homolog 1|tenascin M|teneurin-1
-
Interactome
-
Publication Reference
-
C-terminal region of teneurin-1 co-localizes with the dystroglycan complex in adult mouse testes and regulates testicular size and testosterone production.
Chand D, Colacci M, Dixon K, Kollara A, Brown TJ, Lovejoy DA.
Histochemistry and Cell Biology 2014 Feb; 141(2):191.
Application：Pre-adsorption, Recombinant protein.
-
C-terminal processing of the teneurin proteins: independent actions of a teneurin C-terminal associated peptide in hippocampal cells.
Chand D, Casatti CA, de Lannoy L, Song L, Kollara A, Barsyte-Lovejoy D, Brown TJ, Lovejoy DA.
Molecular and Cellular Neurosciences 2013 Jan; 52:38.
Application：Func, Antiserum.
-
C-terminal region of teneurin-1 co-localizes with the dystroglycan complex in adult mouse testes and regulates testicular size and testosterone production.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com