ODZ1 monoclonal antibody (M01), clone 3G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ODZ1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ODZ1.
Immunogen
ODZ1 (NP_055068, 2616 a.a. ~ 2725 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ODZ1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ODZ1
Entrez GeneID
10178GeneBank Accession#
NM_014253Protein Accession#
NP_055068Gene Name
ODZ1
Gene Alias
ODZ3, TEN-M1, TNM, TNM1
Gene Description
odz, odd Oz/ten-m homolog 1(Drosophila)
Omim ID
300588Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000024333|OTTHUMP00000062724|odz (odd Oz/ten-m, Drosophila) homolog 1|odz (odd Oz/ten-m, Drosophila) homolog 3|odz, odd Oz/ten-m homolog 1|tenascin M|teneurin-1
-
Interactome
-
Publication Reference
-
C-terminal region of teneurin-1 co-localizes with the dystroglycan complex in adult mouse testes and regulates testicular size and testosterone production.
Chand D, Colacci M, Dixon K, Kollara A, Brown TJ, Lovejoy DA.
Histochemistry and Cell Biology 2014 Feb; 141(2):191.
Application：IF, Mouse, Testis.
-
C-terminal processing of the teneurin proteins: independent actions of a teneurin C-terminal associated peptide in hippocampal cells.
Chand D, Casatti CA, de Lannoy L, Song L, Kollara A, Barsyte-Lovejoy D, Brown TJ, Lovejoy DA.
Molecular and Cellular Neurosciences 2013 Jan; 52:38.
Application：IF, IHC-P, WB-Ti, Mouse, Brains, E14 hippocampal cells.
-
C-terminal region of teneurin-1 co-localizes with the dystroglycan complex in adult mouse testes and regulates testicular size and testosterone production.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com