Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ODZ1 polyclonal antibody (A01)

  • Catalog # : H00010178-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ODZ1.
  • Immunogen:
  • ODZ1 (NP_055068, 2616 a.a. ~ 2725 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010178-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ODZ1
  • Gene Alias:
  • ODZ3,TEN-M1,TNM,TNM1
  • Gene Description:
  • odz, odd Oz/ten-m homolog 1(Drosophila)
  • Gene Summary:
  • The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024333,OTTHUMP00000062724,odz (odd Oz/ten-m, Drosophila) homolog 1,odz (odd Oz/ten-m, Drosophila) homolog 3,odz, odd Oz/ten-m homolog 1,tenascin M,teneurin-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook