Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DHRS9 monoclonal antibody (M05), clone 3C6

  • Catalog # : H00010170-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant DHRS9.
  • Immunogen:
  • DHRS9 (AAH58883, 1 a.a. ~ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010170-M05
    Western Blot detection against Immunogen (60.83 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • 1.
  • DHRS9 is a Stable Marker of Human Regulatory Macrophages.
    Riquelme P, Amodio G, Macedo C, Moreau A, Obermajer N, Brochhausen C, Ahrens N, Kekarainen T, Fändrich F, Cuturi C, Gregori S, Metes D, Schlitt HJ, Thomson AW, Geissler EK, Hutchinson JA.Transplantation. 2017 Jun 7. [Epub ahead of print]
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DHRS9
  • Gene Alias:
  • 3ALPHA-HSD,RDH15,RDHL,RDHTBE,RETSDR8,SDR9C4
  • Gene Description:
  • dehydrogenase/reductase (SDR family) member 9
  • Other Designations:
  • 3-alpha hydroxysteroid dehydrogenase,NADP-dependent retinol dehydrogenase/reductase,OTTHUMP00000163043,retinol dehydrogenase homolog,short chain dehydrogenase/reductase family 9C, member 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook