Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC25A15 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010166-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC25A15 partial ORF ( NP_055067.1, 237 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.89
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010166-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SLC25A15
  • Gene Alias:
  • D13S327,HHH,ORC1,ORNT1
  • Gene Description:
  • solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
  • Gene Summary:
  • This gene is a member of the mitochondrial carrier family. The encoded protein transports ornithine across the inner mitochondrial membrane from the cytosol to the mitochondrial matrix. The protein is an essential component of the urea cycle, and functions in ammonium detoxification and biosynthesis of the amino acid arginine. Mutations in this gene result in hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome. There is a pseudogene of this locus on the Y chromosome
  • Other Designations:
  • OTTHUMP00000042249,ornithine transporter 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook