WASF2 monoclonal antibody (M01), clone 1F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
WASF2 monoclonal antibody (M01), clone 1F7. Western Blot analysis of WASF2 expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WASF2 is approximately 0.3ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WASF2.
Immunogen
WASF2 (NP_008921, 73 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WASF2 monoclonal antibody (M01), clone 1F7. Western Blot analysis of WASF2 expression in HeLa ( Cat # L013V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WASF2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — WASF2
Entrez GeneID
10163GeneBank Accession#
NM_006990Protein Accession#
NP_008921Gene Name
WASF2
Gene Alias
SCAR2, WAVE2, dJ393P12.2
Gene Description
WAS protein family, member 2
Omim ID
605875Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. [provided by RefSeq
Other Designations
IMD2|OTTHUMP00000003471|WASP family Verprolin-homologous protein 2|suppressor of cyclic-AMP receptor (WASP-family)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com