Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FARP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010160-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FARP1 partial ORF ( NP_005757.1, 471 a.a. - 549 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.43
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010160-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • FARP1
  • Gene Alias:
  • CDEP,MGC87400,PLEKHC2
  • Gene Description:
  • FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
  • Gene Summary:
  • This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • FERM, RhoGEF, and pleckstrin domain protein 1,OTTHUMP00000018591,OTTHUMP00000040734,chondrocyte-derived ezrin-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook