Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FARP1 purified MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00010160-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FARP1 protein.
  • Immunogen:
  • FARP1 (NP_001001715.1, 1 a.a. ~ 129 a.a) full-length human protein.
  • Sequence:
  • MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FARP1 expression in transfected 293T cell line (H00010160-T01) by FARP1 MaxPab polyclonal antibody.

    Lane 1: FARP1 transfected lysate(14.19 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • FARP1
  • Gene Alias:
  • CDEP,MGC87400,PLEKHC2
  • Gene Description:
  • FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
  • Gene Summary:
  • This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • FERM, RhoGEF, and pleckstrin domain protein 1,OTTHUMP00000018591,OTTHUMP00000040734,chondrocyte-derived ezrin-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook