Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP6AP2 (Human) Recombinant Protein (P01)

  • Catalog # : H00010159-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP6AP2 full-length ORF ( NP_005756.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 65.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010159-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ATP6AP2
  • Gene Alias:
  • APT6M8-9,ATP6IP2,ATP6M8-9,ELDF10,HT028,M8-9,MGC99577,MRXE,MSTP009,XMRE
  • Gene Description:
  • ATPase, H+ transporting, lysosomal accessory protein 2
  • Gene Summary:
  • This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. [provided by RefSeq
  • Other Designations:
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9,ATPase, H+ transporting, lysosomal interacting protein 2,OTTHUMP00000025771,V-ATPase M8.9 subunit,embryonic liver differentiation factor 10,renin receptor,va
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook