ATP6AP2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ATP6AP2 full-length ORF ( NP_005756.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
65.4
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ATP6AP2
Entrez GeneID
10159GeneBank Accession#
NM_005765.2Protein Accession#
NP_005756.2Gene Name
ATP6AP2
Gene Alias
APT6M8-9, ATP6IP2, ATP6M8-9, ELDF10, HT028, M8-9, MGC99577, MRXE, MSTP009, XMRE
Gene Description
ATPase, H+ transporting, lysosomal accessory protein 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9|ATPase, H+ transporting, lysosomal interacting protein 2|OTTHUMP00000025771|V-ATPase M8.9 subunit|embryonic liver differentiation factor 10|renin receptor|va
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com