Product Browser

Last updated: 2017/2/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRIM28 monoclonal antibody (M02), clone 1D11

  • Catalog # : H00010155-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TRIM28.
  • Immunogen:
  • TRIM28 (AAH04978, 379 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010155-M02
    Western Blot detection against Immunogen (41.69 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in MCF-7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody (M02), clone 1D11.

    Lane 1: TRIM28 transfected lysate (Predicted MW: 88.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • TRIM28
  • Gene Alias:
  • FLJ29029,KAP1,RNF96,TF1B,TIF1B
  • Gene Description:
  • tripartite motif-containing 28
  • Gene Summary:
  • The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq
  • Other Designations:
  • KRAB-associated protein 1,nuclear corepressor KAP-1,transcriptional intermediary factor 1-beta,tripartite motif-containing 28 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook