EBI3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EBI3 full-length ORF ( AAH15364.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
50.71
Interspecies Antigen Sequence
Mouse (62); Rat (62)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EBI3
Entrez GeneID
10148GeneBank Accession#
BC015364Protein Accession#
AAH15364.1Gene Name
EBI3
Gene Alias
IL27B
Gene Description
Epstein-Barr virus induced 3
Omim ID
605816Gene Ontology
HyperlinkGene Summary
This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq
Other Designations
Epstein-Barr virus induced gene 3|cytokine receptor|interleukin-27 subunit beta
-
Interactome
-
Publication Reference
-
Stimulated human peripheral T cells produce high amounts of IL-35 protein in a proliferation-dependent manner.
Guttek K, Reinhold D.
Cytokine 2013 Oct; 64(1):46.
Application：ELISA, Human, Supernatants collected from T cells culture medium.
-
Stimulated human peripheral T cells produce high amounts of IL-35 protein in a proliferation-dependent manner.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com