Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKAP9 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010142-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AKAP9 partial ORF ( NP_671700, 3812 a.a. - 3911 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010142-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • AKAP9
  • Gene Alias:
  • AKAP350,AKAP450,CG-NAP,HYPERION,KIAA0803,MU-RMS-40.16A,PRKA9,YOTIAO
  • Gene Description:
  • A kinase (PRKA) anchor protein (yotiao) 9
  • Gene Summary:
  • The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in at least two isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. [provided by RefSeq
  • Other Designations:
  • A-kinase anchor protein 9,A-kinase anchor protein, 350kDa,A-kinase anchoring protein 450,AKAP120-like protein,AKAP9-BRAF fusion protein,centrosome- and golgi-localized protein,kinase N-associated protein,protein kinase A anchoring protein 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook