Product Browser

Last updated: 2017/12/17
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARFRP1 purified MaxPab mouse polyclonal antibody (B03P)MaxPab

  • Catalog # : H00010139-B03P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ARFRP1 protein.
  • Immunogen:
  • ARFRP1 (NP_003215.1, 1 a.a. ~ 201 a.a) full-length human protein.
  • Sequence:
  • MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ARFRP1 expression in transfected 293T cell line (H00010139-T05) by ARFRP1 MaxPab polyclonal antibody.

    Lane 1: ARFRP1 transfected lysate(22.60 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ARFRP1
  • Gene Alias:
  • ARL18,ARP,Arp1
  • Gene Description:
  • ADP-ribosylation factor related protein 1
  • Gene Summary:
  • The protein encoded by this gene is a membrane-associated GTP-ase and localizes to the plasma membrane. It is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) genes. The gene is located in a gene cluster that includes the a gene (M68) that is overexpressed in some tumors. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • ADP-ribosylation factor-related protein 1,ARF-related protein,OTTHUMP00000031584,SCG10 like-protein,helicase-like protein NHL
  • RSS
  • YouTube
  • Linkedin
  • Facebook