Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARFRP1 polyclonal antibody (A01)

  • Catalog # : H00010139-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ARFRP1.
  • Immunogen:
  • ARFRP1 (NP_003215, 133 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • ARFRP1
  • Gene Alias:
  • ARL18,ARP,Arp1
  • Gene Description:
  • ADP-ribosylation factor related protein 1
  • Gene Summary:
  • The protein encoded by this gene is a membrane-associated GTP-ase and localizes to the plasma membrane. It is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) genes. The gene is located in a gene cluster that includes the a gene (M68) that is overexpressed in some tumors. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • ADP-ribosylation factor-related protein 1,ARF-related protein,OTTHUMP00000031584,SCG10 like-protein,helicase-like protein NHL
  • RSS
  • YouTube
  • Linkedin
  • Facebook