Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

YAF2 mouse monoclonal antibody (hybridoma)

  • Catalog # : H00010138-M
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant YAF2.
  • Immunogen:
  • YAF2 (NP_005739.2, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactivity and specificity confirmed by ELISA and Western Blot.
  • Note:
  • Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
  • Deliverables:
  • Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • YAF2
  • Gene Alias:
  • MGC41856
  • Gene Description:
  • YY1 associated factor 2
  • Gene Summary:
  • The protein encoded by this gene interacts with YY1, a zinc finger protein involved in negative regulation of muscle-restricted genes. This gene product itself contains a single N-terminal C2-X10-C2 zinc finger, and in contrast to YY1, is up-regulated during myogenic differentiation. It also facilitates proteolytic cleavage of YY1 by the calcium- activated protease, m-calpain, suggesting a mechanism by which this protein antagonizes the negative effect of YY1. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook