BCAP31 monoclonal antibody (M01A), clone 3C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
BCAP31 monoclonal antibody (M01A), clone 3C5. Western Blot analysis of BCAP31 expression in human kidney.
Western Blot (Cell lysate)
BCAP31 monoclonal antibody (M01A), clone 3C5. Western Blot analysis of BCAP31 expression in HeLa(Cat # L013V1 ).
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BCAP31.
Immunogen
BCAP31 (NP_005736, 137 a.a. ~ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BCAP31 monoclonal antibody (M01A), clone 3C5. Western Blot analysis of BCAP31 expression in human kidney.Western Blot (Cell lysate)
BCAP31 monoclonal antibody (M01A), clone 3C5. Western Blot analysis of BCAP31 expression in HeLa(Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — BCAP31
Entrez GeneID
10134GeneBank Accession#
NM_005745Protein Accession#
NP_005736Gene Name
BCAP31
Gene Alias
6C6-AG, BAP31, CDM, DXS1357E
Gene Description
B-cell receptor-associated protein 31
Omim ID
300398Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome. Two pseudogenes have been identified on chromosome 16. Alternatively spliced transcript variants encoding distinct isoforms have been described although the biological validity of some of the variants has not been determined. [provided by RefSeq
Other Designations
6C6 antigen|BCR-associated protein Bap31|OTTHUMP00000025977|OTTHUMP00000025978|p28 Bap31
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com