BCAP31 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human BCAP31 protein.
Immunogen
BCAP31 (NP_005736.3, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (90); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BCAP31 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP31 expression in human spleen.Western Blot (Tissue lysate)
BCAP31 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP31 expression in mouse intestine.Western Blot (Transfected lysate)
Western Blot analysis of BCAP31 expression in transfected 293T cell line (H00010134-T01) by BCAP31 MaxPab polyclonal antibody.
Lane 1: BCAP31 transfected lysate(28.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — BCAP31
Entrez GeneID
10134GeneBank Accession#
NM_005745Protein Accession#
NP_005736.3Gene Name
BCAP31
Gene Alias
6C6-AG, BAP31, CDM, DXS1357E
Gene Description
B-cell receptor-associated protein 31
Omim ID
300398Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome. Two pseudogenes have been identified on chromosome 16. Alternatively spliced transcript variants encoding distinct isoforms have been described although the biological validity of some of the variants has not been determined. [provided by RefSeq
Other Designations
6C6 antigen|BCR-associated protein Bap31|OTTHUMP00000025977|OTTHUMP00000025978|p28 Bap31
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com