ACTR1A MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ACTR1A protein.
Immunogen
ACTR1A (NP_005727.1, 1 a.a. ~ 376 a.a) full-length human protein.
Sequence
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ACTR1A MaxPab polyclonal antibody. Western Blot analysis of ACTR1A expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of ACTR1A expression in transfected 293T cell line (H00010121-T01) by ACTR1A MaxPab polyclonal antibody.
Lane 1: ACTR1A transfected lysate(41.36 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ACTR1A
Entrez GeneID
10121GeneBank Accession#
NM_005736.2Protein Accession#
NP_005727.1Gene Name
ACTR1A
Gene Alias
ARP1, CTRN1, FLJ52695, FLJ52800, FLJ55002
Gene Description
ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
Omim ID
605143Gene Ontology
HyperlinkGene Summary
This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. [provided by RefSeq
Other Designations
ARP1 actin-related protein 1 homolog A, centractin alpha|ARP1, yeast homolog A|OTTHUMP00000020366|actin-RPV|centractin alpha|centrosome-associated actin homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com