SGK2 monoclonal antibody (M02), clone 1A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SGK2 monoclonal antibody (M02), clone 1A7 Western Blot analysis of SGK2 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of SGK2 expression in transfected 293T cell line by SGK2 monoclonal antibody (M02), clone 1A7.
Lane 1: SGK2 transfected lysate(41.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SGK2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.88 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SGK2.
Immunogen
SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.88 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SGK2 monoclonal antibody (M02), clone 1A7 Western Blot analysis of SGK2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SGK2 expression in transfected 293T cell line by SGK2 monoclonal antibody (M02), clone 1A7.
Lane 1: SGK2 transfected lysate(41.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SGK2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — SGK2
Entrez GeneID
10110GeneBank Accession#
BC065511Protein Accession#
AAH65511Gene Name
SGK2
Gene Alias
H-SGK2, dJ138B7.2
Gene Description
serum/glucocorticoid regulated kinase 2
Omim ID
607589Gene Ontology
HyperlinkGene Summary
This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000031702|OTTHUMP00000031703|OTTHUMP00000031705
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com