SGK2 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SGK2 MaxPab rabbit polyclonal antibody. Western Blot analysis of SGK2 expression in mouse stomach.
Western Blot (Transfected lysate)
Western Blot analysis of SGK2 expression in transfected 293T cell line (H00010110-T02) by SGK2 MaxPab polyclonal antibody.
Lane 1: SGK2 transfected lysate(41.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SGK2 transfected lysate using anti-SGK2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGK2 purified MaxPab mouse polyclonal antibody (B01P) (H00010110-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SGK2 protein.
Immunogen
SGK2 (NP_733794.1, 1 a.a. ~ 367 a.a) full-length human protein.
Sequence
MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SGK2 MaxPab rabbit polyclonal antibody. Western Blot analysis of SGK2 expression in mouse stomach.Western Blot (Transfected lysate)
Western Blot analysis of SGK2 expression in transfected 293T cell line (H00010110-T02) by SGK2 MaxPab polyclonal antibody.
Lane 1: SGK2 transfected lysate(41.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SGK2 transfected lysate using anti-SGK2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGK2 purified MaxPab mouse polyclonal antibody (B01P) (H00010110-B01P). -
Gene Info — SGK2
Entrez GeneID
10110GeneBank Accession#
NM_170693.1Protein Accession#
NP_733794.1Gene Name
SGK2
Gene Alias
H-SGK2, dJ138B7.2
Gene Description
serum/glucocorticoid regulated kinase 2
Omim ID
607589Gene Ontology
HyperlinkGene Summary
This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000031702|OTTHUMP00000031703|OTTHUMP00000031705
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com