ARPC2 monoclonal antibody (M01), clone 5C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8 Western Blot analysis of ARPC2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8. Western Blot analysis of ARPC2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8. Western Blot analysis of ARPC2 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8. Western Blot analysis of ARPC2 expression in Raw 264.7 ( Cat # L024V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARPC2 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (58.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ARPC2.
Immunogen
ARPC2 (AAH00590, 1 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (58.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8 Western Blot analysis of ARPC2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8. Western Blot analysis of ARPC2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8. Western Blot analysis of ARPC2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
ARPC2 monoclonal antibody (M01), clone 5C8. Western Blot analysis of ARPC2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARPC2 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — ARPC2
Entrez GeneID
10109GeneBank Accession#
BC000590Protein Accession#
AAH00590Gene Name
ARPC2
Gene Alias
ARC34, PNAS-139, PRO2446, p34-Arc
Gene Description
actin related protein 2/3 complex, subunit 2, 34kDa
Omim ID
604224Gene Ontology
HyperlinkGene Summary
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq
Other Designations
ARP2/3 protein complex subunit 34|OTTHUMP00000164144|actin related protein 2/3 complex subunit 2|actin related protein 2/3 complex, subunit 2 (34 kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com