Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRIM10 polyclonal antibody (A01)

  • Catalog # : H00010107-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TRIM10.
  • Immunogen:
  • TRIM10 (NP_006769, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLCKEPFRPGSFRPNWQLANVVENIERLQLVSTLGLGEEDVCQEHGGKIYFFC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010107-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TRIM10
  • Gene Alias:
  • HERF1,MGC141979,RFB30,RNF9
  • Gene Description:
  • tripartite motif-containing 10
  • Gene Summary:
  • The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029430,Zn-finger protein,hematopoietic RING finger 1,ring finger protein 9,tripartite motif protein 10
  • RSS
  • YouTube
  • Linkedin
  • Facebook