Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIF (Human) Recombinant Protein (Q01)

  • Catalog # : H00010105-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPIF partial ORF ( NP_005720, 120 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010105-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PPIF
  • Gene Alias:
  • CYP3,Cyp-D,FLJ90798,MGC117207
  • Gene Description:
  • peptidylprolyl isomerase F
  • Gene Summary:
  • The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019925,PPIase,cyclophilin 3,cyclophilin D,cyclophilin F,peptidyl-prolyl cis-trans isomerase, mitochondral,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook