Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIF polyclonal antibody (A01)

  • Catalog # : H00010105-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPIF.
  • Immunogen:
  • PPIF (NP_005720, 120 a.a. ~ 207 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010105-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PPIF
  • Gene Alias:
  • CYP3,Cyp-D,FLJ90798,MGC117207
  • Gene Description:
  • peptidylprolyl isomerase F
  • Gene Summary:
  • The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019925,PPIase,cyclophilin 3,cyclophilin D,cyclophilin F,peptidyl-prolyl cis-trans isomerase, mitochondral,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook