TSPAN1 monoclonal antibody (M05), clone 3B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSPAN1 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.96 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TSPAN1.
Immunogen
TSPAN1 (NP_005718, 110 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSPAN1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — TSPAN1
Entrez GeneID
10103GeneBank Accession#
NM_005727Protein Accession#
NP_005718Gene Name
TSPAN1
Gene Alias
9030418M05Rik, NET-1, RP11-322N21.1, TSPAN-1
Gene Description
tetraspanin 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq
Other Designations
OTTHUMP00000008900|tetraspan 1|tetraspan 1 (TSPAN-1)|tetraspan NET-1|tetraspan TM4SF|tetraspanin TM4-C
-
Interactome
-
Disease
-
Publication Reference
-
Discovery of a diagnostic biomarker for colon cancer through proteomic profiling of small extracellular vesicles.
Lee CH, Im EJ, Moon PG, Baek MC.
BMC Cancer 2018 Nov; 18(1):1058.
Application：WB-Ce, Human, HT-29, HCT-116, CRL-1541 cells.
-
Tspan-1 interacts with the thiamine transporter-1 in human intestinal epithelial cells and modulates its stability.
Nabokina SM, Senthilkumar SR, Said HM.
American Journal of Physiology. Gastrointestinal and Liver Physiology 2011 Nov; 301(5):G808.
Application：WB-Tr, Human, Caco-2, HuTu-80 cells.
-
Discovery of a diagnostic biomarker for colon cancer through proteomic profiling of small extracellular vesicles.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com