Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSPAN2 polyclonal antibody (A01)

  • Catalog # : H00010100-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TSPAN2.
  • Immunogen:
  • TSPAN2 (NP_005716, 112 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010100-A01
    Western Blot detection against Immunogen (34.47 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TSPAN2
  • Gene Alias:
  • 6330415F13Rik,FLJ12082,TSN2,TSPAN-2
  • Gene Description:
  • tetraspanin 2
  • Gene Summary:
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000013651,tetraspan 2,tetraspan TM4SF
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook