ACTR3 monoclonal antibody (M02), clone 2B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ACTR3 monoclonal antibody (M02), clone 2B6 Western Blot analysis of ACTR3 expression in A-431 ( Cat # L015V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACTR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACTR3 is 10 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACTR3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (71.72 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ACTR3.
Immunogen
ACTR3 (AAH44590, 1 a.a. ~ 418 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIAEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (71.72 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACTR3 monoclonal antibody (M02), clone 2B6 Western Blot analysis of ACTR3 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACTR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACTR3 is 10 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACTR3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ACTR3
Entrez GeneID
10096GeneBank Accession#
BC044590Protein Accession#
AAH44590Gene Name
ACTR3
Gene Alias
ARP3
Gene Description
ARP3 actin-related protein 3 homolog (yeast)
Omim ID
604222Gene Ontology
HyperlinkGene Summary
The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. [provided by RefSeq
Other Designations
ARP3 actin-related protein 3 homolog
-
Interactome
-
Publication Reference
-
Laser Microdissection and Two-Dimensional Difference Gel Electrophoresis Reveal the Role of a Novel Macrophage-Capping Protein in Lymph Node Metastasis in Gastric Cancer.
Ichikawa H, Kanda T, Kosugi SI, Kawachi Y, Sasaki H, Wakai T, Kondo T.
Journal of Proteome Research 2013 Aug; 12(8):3780.
Application：WB-Ti, Human, Gastric cancer.
-
Annexin A2-Dependent Polymerization of Actin Mediates Endosome Biogenesis.
Morel E, Parton RG, Gruenberg J.
Developmental Cell 2009 Mar; 16(3):445.
Application：WB, Hamster, BHK cells.
-
Laser Microdissection and Two-Dimensional Difference Gel Electrophoresis Reveal the Role of a Novel Macrophage-Capping Protein in Lymph Node Metastasis in Gastric Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com