ARPC3 monoclonal antibody (M06), clone 2E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ARPC3 expression in transfected 293T cell line by ARPC3 monoclonal antibody (M06), clone 2E11.
Lane 1: ARPC3 transfected lysate(20.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARPC3 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.32 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARPC3.
Immunogen
ARPC3 (NP_005710.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISEC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.32 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ARPC3 expression in transfected 293T cell line by ARPC3 monoclonal antibody (M06), clone 2E11.
Lane 1: ARPC3 transfected lysate(20.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARPC3 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ARPC3
Entrez GeneID
10094GeneBank Accession#
NM_005719Protein Accession#
NP_005710.1Gene Name
ARPC3
Gene Alias
ARC21, p21-Arc
Gene Description
actin related protein 2/3 complex, subunit 3, 21kDa
Omim ID
604225Gene Ontology
HyperlinkGene Summary
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p21 subunit, has yet to be determined. [provided by RefSeq
Other Designations
ARP2/3 protein complex subunit p21|actin related protein 2/3 complex subunit 3|actin related protein 2/3 complex, subunit 3 (21 kD)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com