Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARPC4 (Human) Recombinant Protein (P01)

  • Catalog # : H00010093-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARPC4 full-length ORF ( NP_001020130.1, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010093-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ARPC4
  • Gene Alias:
  • ARC20,MGC13544,p20-Arc
  • Gene Description:
  • actin related protein 2/3 complex, subunit 4, 20kDa
  • Gene Summary:
  • This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p20 subunit, has yet to be determined. Three transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Arp2/3 protein complex subunit p20,OTTHUMP00000165252,actin related protein 2/3 complex subunit 4,actin related protein 2/3 complex, subunit 4 (20 kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook