Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARPC5 polyclonal antibody (A01)

  • Catalog # : H00010092-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant ARPC5.
  • Immunogen:
  • ARPC5 (AAH57237, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010092-A01
    Western Blot detection against Immunogen (43.05 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ARPC5 polyclonal antibody (A01), Lot # 051206JC01 Western Blot analysis of ARPC5 expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ARPC5
  • Gene Alias:
  • ARC16,MGC88523,dJ127C7.3,p16-Arc
  • Gene Description:
  • actin related protein 2/3 complex, subunit 5, 16kDa
  • Gene Summary:
  • This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. [provided by RefSeq
  • Other Designations:
  • Arp2/3 protein complex subunit p16,OTTHUMP00000033266,actin related protein 2/3 complex subunit 5,actin related protein 2/3 complex, subunit 5 (16 kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook