Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COL4A3BP polyclonal antibody (A01)

  • Catalog # : H00010087-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant COL4A3BP.
  • Immunogen:
  • COL4A3BP (NP_112729, 499 a.a. ~ 598 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010087-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • COL4A3BP polyclonal antibody (A01), Lot # 060113JC01 Western Blot analysis of COL4A3BP expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • COL4A3BP
  • Gene Alias:
  • CERT,CERTL,FLJ20597,GPBP,STARD11
  • Gene Description:
  • collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
  • Gene Summary:
  • This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Goodpasture antigen-binding protein,OTTHUMP00000128248,OTTHUMP00000128249,START domain containing 11,StAR-related lipid transfer (START) domain containing 11,alpha 3 type IV collagen binding protein,ceramide transporter,lipid-transfer protein CERTL
  • RSS
  • YouTube
  • Linkedin
  • Facebook