Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDIL3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010085-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EDIL3 partial ORF ( NP_005702, 101 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010085-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • EDIL3
  • Gene Alias:
  • DEL1,MGC26287
  • Gene Description:
  • EGF-like repeats and discoidin I-like domains 3
  • Gene Summary:
  • The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq
  • Other Designations:
  • EGF-like repeats and discoidin I-like domains-containing protein 3,developmental endothelial locus-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook