EDIL3 monoclonal antibody (M01J), clone 4C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EDIL3 monoclonal antibody (M01J), clone 4C9. Western Blot analysis of EDIL3 expression in human pancreas.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EDIL3 is 3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to EDIL3 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EDIL3.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
EDIL3 (NP_005702, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EDIL3 monoclonal antibody (M01J), clone 4C9. Western Blot analysis of EDIL3 expression in human pancreas.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EDIL3 is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EDIL3 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — EDIL3
Entrez GeneID
10085GeneBank Accession#
NM_005711Protein Accession#
NP_005702Gene Name
EDIL3
Gene Alias
DEL1, MGC26287
Gene Description
EGF-like repeats and discoidin I-like domains 3
Omim ID
606018Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq
Other Designations
EGF-like repeats and discoidin I-like domains-containing protein 3|developmental endothelial locus-1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com