EDIL3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EDIL3 expression in transfected 293T cell line (H00010085-T01) by EDIL3 MaxPab polyclonal antibody.
Lane 1: EDIL3 transfected lysate(52.8 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human EDIL3 protein.
Immunogen
EDIL3 (NP_005702.3, 1 a.a. ~ 480 a.a) full-length human protein.
Sequence
MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EDIL3 expression in transfected 293T cell line (H00010085-T01) by EDIL3 MaxPab polyclonal antibody.
Lane 1: EDIL3 transfected lysate(52.8 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EDIL3
Entrez GeneID
10085GeneBank Accession#
NM_005711.3Protein Accession#
NP_005702.3Gene Name
EDIL3
Gene Alias
DEL1, MGC26287
Gene Description
EGF-like repeats and discoidin I-like domains 3
Omim ID
606018Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq
Other Designations
EGF-like repeats and discoidin I-like domains-containing protein 3|developmental endothelial locus-1
-
Interactome
-
Disease
-
Publication Reference
-
Proteomic and functional analysis of human sperm detergent resistant membranes.
Ebert B, Kisiela M, Wsol V, Maser E.
Journal of Cellular Physiology 2011 Oct; 226(10):2651.
Application：IF, WB, Human, Human Sperm.
-
Proteomic and functional analysis of human sperm detergent resistant membranes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com