Product Browser

Last updated: 2017/9/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PQBP1 monoclonal antibody (M01), clone 1A11

  • Catalog # : H00010084-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PQBP1.
  • Immunogen:
  • PQBP1 (NP_005701, 184 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010084-M01
    Western Blot detection against Immunogen (34.76 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PQBP1 expression in transfected 293T cell line by PQBP1 monoclonal antibody (M01), clone 1A11.

    Lane 1: PQBP1 transfected lysate(30.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PQBP1 is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • PQBP1
  • Gene Alias:
  • MRX55,MRXS3,MRXS8,NPW38,RENS1,SHS
  • Gene Description:
  • polyglutamine binding protein 1
  • Gene Summary:
  • PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain (Waragai et al., 1999 [PubMed 10332029]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000025808,nuclear protein containing WW domain 38 kD
  • RSS
  • YouTube
  • Linkedin
  • Facebook