Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PHEMX (Human) Recombinant Protein (Q01)

  • Catalog # : H00010077-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PHEMX partial ORF ( NP_005696, 194 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.41
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010077-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TSPAN32
  • Gene Alias:
  • FLJ17158,FLJ97586,MGC22455,PHEMX,PHMX,TSSC6
  • Gene Description:
  • tetraspanin 32
  • Gene Summary:
  • This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • pan-hematopoietic expression protein,tumor-suppressing STF cDNA 6,tumor-suppressing subchromosomal transferable fragment cDNA 6,tumor-suppressing subtransferable candidate 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook