Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HUWE1 polyclonal antibody (A01)

  • Catalog # : H00010075-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HUWE1.
  • Immunogen:
  • HUWE1 (NP_113584, 4281 a.a. ~ 4374 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010075-A01
    Western Blot detection against Immunogen (36.45 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HUWE1
  • Gene Alias:
  • ARF-BP1,HECTH9,HSPC272,Ib772,KIAA0312,LASU1,MULE,UREB1
  • Gene Description:
  • HECT, UBA and WWE domain containing 1
  • Other Designations:
  • ARF binding protein 1,BJ-HCC-24 tumor antigen,HECT domain protein LASU1,Mcl-1 ubiquitin ligase E3,OTTHUMP00000023356,OTTHUMP00000061860
  • RSS
  • YouTube
  • Linkedin
  • Facebook