DPP3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DPP3 partial ORF ( NP_005691.2, 424 a.a. - 504 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIAS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.65
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DPP3
Entrez GeneID
10072GeneBank Accession#
NM_005700Protein Accession#
NP_005691.2Gene Name
DPP3
Gene Alias
DPPIII, FLJ11387, FLJ22331
Gene Description
dipeptidyl-peptidase 3
Omim ID
606818Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternate transcriptional splice variants have been characterized. [provided by RefSeq
Other Designations
dipeptidyl aminopeptidase III|dipeptidyl arylamidase III|dipeptidyl peptidase III|dipeptidylpeptidase 3|dipeptidylpeptidase III
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com