Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL18BP (Human) Recombinant Protein (P01)

  • Catalog # : H00010068-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL18BP full-length ORF ( AAH44215, 31 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.78
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010068-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IL18BP
  • Gene Alias:
  • IL18BPa
  • Gene Description:
  • interleukin 18 binding protein
  • Gene Summary:
  • The protein encoded by this gene is an inhibitor of the proinflammatory cytokine IL18. This protein binds to IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production. This protein is constitutively expressed and secreted in mononuclear cells. The expression of this protein can be enhanced by IFN-gamma. An elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • MC51L-53L-54L homolog gene product,OTTHUMP00000179141,OTTHUMP00000179143
  • RSS
  • YouTube
  • Linkedin
  • Facebook